SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929693|ref|YP_003422215.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929693|ref|YP_003422215.1|
Domain Number 1 Region: 301-600
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 4.71e-75
Family DNA repair protein MutS, domain III 0.00000587
Further Details:      
 
Domain Number 2 Region: 602-838
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.75e-59
Family ABC transporter ATPase domain-like 0.000000938
Further Details:      
 
Domain Number 3 Region: 137-201,231-314
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.44e-40
Family DNA repair protein MutS, domain II 0.0006
Further Details:      
 
Domain Number 4 Region: 18-135
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 4.84e-32
Family DNA repair protein MutS, domain I 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929693|ref|YP_003422215.1|
Sequence length 854
Comment DNA mismatch repair protein MutS [cyanobacterium UCYN-A]
Sequence
MYNSKRSNVSPHTDHRLLDFEDLTPMYRHYINIKEEYISSLLLYRVGDFFECFFQDAVTV
SKEVGTFLTSKEAGKKIGRIALTGFPHHSLDRYAKLLIDRGYSIAICDQVEDSLEALSQG
RMVERRVTKLLTPGTLMDDELLVPENSNFLVALTIRDNLWGLAYADISTGEFCTTQGVDL
SNLKSELLRLQPAEVIIPANDIDSGRMIRPGEESSLLIDAFPDCFCYSLRTKTTFDLNTA
REKLLNAFKVSSLEGMGCHDLPLAISAAGGLLKYIEDTQIDQQLTLQLPKNYNLNDFLII
DYQTRRNLEITKTIKNSIFKGSLLSTIQKPKTSMGARDLQRWLIEPLLSIERITERQDTV
EELVEDITLRHDLKKLLASIHDLERISTKVTSETANARHLSCLANSLLKLKDLSKLAHRG
KSFYFKALQNTPKELEKLGIYIRSHLIESLPVKLKEGGIIKDGVNAELDNMRSQIEDDRE
WLSNLEATERQKTGIASLKVSYSKSFGFYISLPRSKASQAPAYFIRRQTLTNEERFITPE
LKEREVRILNAQKNLKKLEYKVFTELRSKVAKKGYAVYQIAKSIAAIDILLSFAITAVEK
NYCRPQILEDQLLKINNGRHPVVEELLPPGSFVPNSVSLKSSSKVLEEPNLIILTGPNSS
GKSCYLRQIGVIQLLAQAGSFVPATSAQIGIADRIFTRVGAVDDLATGQSTFMVEMNETA
NILNHATEKSLILLDEVGRGTSTFDGLSIAWAIAEYLSEEIGGKTIFATHYHELNELASK
VSRVANFQTIVEEKPDSLIFLHQIRPGGAKKSYGIEVAKLAGLPSSVTTRAKKIMEKVSQ
SSRIILKLNELEDN
Download sequence
Identical sequences D3EQT4
gi|284929693|ref|YP_003422215.1| WP_012954521.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]