SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929696|ref|YP_003422218.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929696|ref|YP_003422218.1|
Domain Number 1 Region: 203-402
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.49e-59
Family B3/B4 domain of PheRS, PheT 0.0000191
Further Details:      
 
Domain Number 2 Region: 38-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.14e-39
Family Myf domain 0.0025
Further Details:      
 
Domain Number 3 Region: 489-702
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.49e-36
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00028
Further Details:      
 
Domain Number 4 Region: 713-812
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.1e-29
Family Anticodon-binding domain of PheRS 0.00094
Further Details:      
 
Domain Number 5 Region: 415-496
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000229
Family Domains B1 and B5 of PheRS-beta, PheT 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284929696|ref|YP_003422218.1|
Sequence length 813
Comment phenylalanyl-tRNA synthetase subunit beta [cyanobacterium UCYN-A]
Sequence
MKISVKWLRELTNFNFSHEELADILTVVGLEVDECENLNEWVNGIVVGLIKDCQPHPDAQ
KLNICKVDIGVEKLLNIVCGASNVEIGKYVPVATLGSYLPTIDLKIEPTELRGINSEGMI
CSLSEIGLSKESSGIHIFEENALTIGQNVAPLLGLDDVILSVMPTANRPDAMSMIGIARE
LASLTGNTVNSPRDIKNFIFEHKNNFLKIEVKDINACPIYIGTIIKNATVTSSPKWLQQK
LKVSGIEPINNIVDVTNLVLLEWGQPMHAFDLKKLNKIADNSNELKIGIRYSNNEETLQI
LDGSSKELNKKNLIITSNDVPVALAGIMGGKTTEIDNQTQDIFLETALFDQVVIRHSSKN
QNLRTEASIRYERGVNQFELEIASQNAISLIEELTGGTAVTQSIIDNRSQVNISQITLRL
ERVHKILGPVWRDGLKSFITSEEVHNILKNLGCKLDLTDKISNVWSVVVPSYRYRDLHRE
IDLIEEIARIYGYGNFCDELPYKTEPGKLSQEYCIERKLREAFRSTGLHELVQYSLVKPE
KADIVLANPLLTEYSALRNNLLDGLINTFAYNQSQGNRPLNGFEIGKIFHSIDGQNRESD
RISGIMGGTFLVEGRWTTGGKVPPMTWYKSKGVLDSIFKKFKIIVEYKTHKEDKRLHPER
TASLWLNNKFLGIFGQLHPQICQELNLIGAVYGFELDFQLLLDTLNQETFLTPTFKPYSF
YPPIELDLAFFVSLDIPVNQLIQKMKEVGGNLLKEIELFDDYRGESVPERQRNLAFSLLY
RSNERTLTDKDVGTIHNKVRESLVEEFNVTLRS
Download sequence
Identical sequences D3EQT7
gi|284929696|ref|YP_003422218.1| WP_012954524.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]