SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929713|ref|YP_003422235.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929713|ref|YP_003422235.1|
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Ribosomal protein L20 3.01e-48
Family Ribosomal protein L20 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929713|ref|YP_003422235.1|
Sequence length 117
Comment 50S ribosomal protein L20P [cyanobacterium UCYN-A]
Sequence
MTRVKRGNVARKRRKKILKLAKGFRGSHSRLFRIANQQVMKALRNAYRDRRKRKRDFRRL
WITRINAAARQNGISYSKLVGLMKKSSISINRKMLAHLAIVDFEAFTEVVEAAKVAK
Download sequence
Identical sequences D3EQV4
WP_012954541.1.87152 gi|284929713|ref|YP_003422235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]