SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929781|ref|YP_003422303.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929781|ref|YP_003422303.1|
Domain Number 1 Region: 1-24
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00000134
Family Ribosomal protein L32p 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929781|ref|YP_003422303.1|
Sequence length 59
Comment 50S ribosomal protein L32P [cyanobacterium UCYN-A]
Sequence
MAVPKKKTSNSKRDHRKAHWKRTAALQAAKALSLGKSVLSGRSNSFVYPKDEEAEEEEE
Download sequence
Identical sequences D3ER22
gi|284929781|ref|YP_003422303.1| WP_012954609.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]