SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929784|ref|YP_003422306.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|284929784|ref|YP_003422306.1|
Domain Number - Region: 248-265
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0641
Family FtsH protease domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929784|ref|YP_003422306.1|
Sequence length 484
Comment putative membrane-associated Zn-dependent protease [cyanobacterium UCYN-A]
Sequence
MLTLSEKALIFFSLTITIGIFFLINNQTNFSKGIKFFSRLRLISLISPWIIIFAFLFFEI
ELSLINIFLILLPSSLSYIYISQLIKRKQEEKLKEDDLLQVKLDSNKNANGSLIISQDLL
IMKNIFSIDTFFSTESIPYEEGIIFRGNLRGDPDATYKLLSSKLRTHFDEKYCLFLVEGN
EGKPVVIVLPNTNNHKAMTTLQKNLAIVLFLATVVTSLEKTSILLGFDLFDNWNRFHEVI
PITLALWIIIAFHEIGHLLVASFYNIKLSWPFFLPIWEIGSFGAITRFESLIPNRKTLFD
ISFAGPAFSGIISIVLLVCGLIFSHPGSLLQMTTQSFQKSILISVLAKFILGDQLKNSII
DINPLFIIGWLGLIITALNLMPAGQLDGGRILQSIYGRETVRKSTIITLIILGIVTILNP
TNPIPLYWIMFILFLQRDTEKPSLNELTEPNNIRAILALISISIMLLILMPLNSLLVESL
GMGG
Download sequence
Identical sequences D3ER25
gi|284929784|ref|YP_003422306.1| WP_012954612.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]