SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385326306|ref|YP_005880743.1| from Mycoplasma gallisepticum str. F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385326306|ref|YP_005880743.1|
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily PTS system IIB component-like 9.94e-22
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385326306|ref|YP_005880743.1|
Sequence length 91
Comment PTS system mannitol-specific (MtlA)-like IIB domain protein [Mycoplasma gallisepticum str. F]
Sequence
MFACEAGMGSSAMGAGMIKKMINNLGVKGVEVANCAIKDLPNDIDIIITQKTFVDYVSKK
YKNSYVYGVNQYLKKDEYKELIDTFKQERLA
Download sequence
Identical sequences gi|385326306|ref|YP_005880743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]