SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385326445|ref|YP_005880882.1| from Mycoplasma gallisepticum str. F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385326445|ref|YP_005880882.1|
Domain Number 1 Region: 9-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-59
Family G proteins 0.000000164
Further Details:      
 
Domain Number 2 Region: 298-393
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.08e-32
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 205-301
Classification Level Classification E-value
Superfamily Translation proteins 4.12e-31
Family Elongation factors 0.00000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385326445|ref|YP_005880882.1|
Sequence length 394
Comment translation longation factor Tu (EF-Tu) [Mycoplasma gallisepticum str. F]
Sequence
MAKERFDRSKPHVNIGTIGHIDHGKTTLTAAICTVLSKAGTSEAKKYDEIDAAPEEKARG
ITINTAHVEYATQNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSATDGPMPQTREHI
LLARQVGVPKMVVFLNKCDVADDPEMQELVEMEVRDLLKSYGFDGDNTPVIRGSALGALN
GEPAWEEKIHELMKAVDEYIPTPDREVDKPFLLPIEDTMTITGRGTVVTGRVERGQLKVG
EEVEIVGITDTRKVVVTGIEMFRKELDAAMAGDNAGILLRGVDRKDVQRGQVLAKPGSIT
PHKKFRAEIYALKKDEGGRHTAFLNGYRPQFYFRTTDVTGSIQLKEGTEMVMPGDNTEII
VELISSIACEKGSKFSIREGGRTVGAGTVVEVLE
Download sequence
Identical sequences A0A0F6CKA9 P18906
gi|385326445|ref|YP_005880882.1| gi|385325330|ref|YP_005879768.1| 233150.MGA_1033 WP_011113468.1.10884 WP_011113468.1.30281 WP_011113468.1.30373 WP_011113468.1.56312 WP_011113468.1.95389 gi|565626980|ref|YP_008894161.1| gi|161511510|ref|NP_853008.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]