SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929017|ref|YP_003421539.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929017|ref|YP_003421539.1|
Domain Number 1 Region: 1-52,808-995
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.54e-25
Family ABC transporter ATPase domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 1-276
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-24
Family ABC transporter ATPase domain-like 0.0023
Further Details:      
 
Domain Number 3 Region: 453-542
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0000000000000615
Family Rad50 coiled-coil Zn hook 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929017|ref|YP_003421539.1|
Sequence length 1008
Comment RecF/RecN/SMC N-terminal domain-containing protein, partial [cyanobacterium UCYN-A]
Sequence
MIPLKLTLKNFLSYQDVTLDFQGLHTVCICGANGAGKSSLLEAIAWTVWGQGRTSSDEDV
IHASADYVRTDFVFICYQEVYRIIRSRQRNRTNSLDFQIKSSEGFTPLSRKGVKATQESI
ISTLKLDYETFINSAYLRQGRADEFMLRRPTERKKVLADLLKLDHYENLSIKAKELARQY
KGKSEQIKLNIEANKKRLIKEKSIRIQQKMIQENIEVLNILQNKNEKVFQFIKQEDSDRK
SWLDKLLWNQERLKNLQQEIFKFRQEKEELSRKIYSYGNLINQGIKVSRKYKKLLFFRNQ
EENLANQFNIFQEFHKKKQDLEKQLLDEDNKLQLKIHQQKIGLEQLEKEEKELKNFLNNA
EDLKSALKTFDFYNQELKRLDKLRCKVSPLFKEKQELTNQTLKIQIDFEARLGQLYISEV
NYLKELGTILQKRKILCSLNDDIHDLEDEKGHHKQIKDKIQEKKIVQGKLFIDKQNNIKE
IDKLQQKIHELNIYHSNCPLCEQKLDRNRRHDVIKKIARQYKNIQKQIYKVQEKVDILEE
NINLFIFKENFLAEKLQYLNKIQQRFCQIETQLNRSGEIKDKLNSVIKEKIRVEKTIKSE
SFDLTLQNRLKNIEKKLAELNYTEENHILVRNKVDEWRWADIKNSKVNDLIYRQDQISQQ
KSDLVQQINQLGKQEEKLNNISRLKKRINLVEKRIKTLNYDKSAHEQISNSIRSSQQCVI
TYEKLQNAKKSYPLLQKYLKFTEDKLRNNYEEQNNIVKIINRLSDKLSITINYDKEIVKL
TTTLKIQRQNLDKLFGKQGRSEQAISEFKILQNEKRELQASYNNTCRQYRIHLELTKAFS
KNGIQLLMIENVLPQLEAETNKILTRLTGNELHIQFITQKLGKGITIRKKSTKLIDTLDI
LIADTEGTRVYETYSGGEAFRINFSVRLALAKLLAQRAGASLQMLIIDEGFGTQDTEGCE
RLIGAINSIASDFSCILIVTHMPQFQEAFQHRIEISKTHQGSQINIIN
Download sequence
Identical sequences D3ENY1
gi|284929017|ref|YP_003421539.1| WP_012953846.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]