SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284929243|ref|YP_003421765.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929243|ref|YP_003421765.1|
Domain Number 1 Region: 10-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929243|ref|YP_003421765.1|
Sequence length 119
Comment anti-anti-sigma regulatory factor [cyanobacterium UCYN-A]
Sequence
MIGNHLIYFGTAVFEPNGYITSNNVSDFQKELNSFIKNNSCKKFLVDMEQVEFIDSTGLI
AMVSACRLAQSFNKKLSVCSLSPSVRIIFELTQLDQALEIYNDRQSYIYETSNNETLTI
Download sequence
Identical sequences D3EPI4
gi|284929243|ref|YP_003421765.1| WP_012954071.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]