SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471261151|ref|YP_007644006.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471261151|ref|YP_007644006.1|
Domain Number 1 Region: 10-199
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.92e-66
Family Clp protease, ClpP subunit 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|471261151|ref|YP_007644006.1|
Sequence length 202
Comment ATP-dependent Clp protease proteolytic subunit [Bdellovibrio exovorus JSS]
Sequence
MPLLPYVIEQTSKGERSYDIYSRLLKDRIVILGSAVTDEVANAIVAQFLFLEVDNPEKDI
HFYINSPGGSVSAGMAIYDIMQFVKCDVATYCMGMAASMGSLLLTAGAAGKRYTMPNSRI
MIHQPLLAGGGLSGQVTDIEIHAKELIKTKEKLTRIYEKHTGKDYNTLHAAMERDNFMDA
ETAKSFGLLDHIVTSRKAVKKG
Download sequence
Identical sequences M4VMT6
WP_015468889.1.98289 gi|471261151|ref|YP_007644006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]