SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471261159|ref|YP_007644014.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471261159|ref|YP_007644014.1|
Domain Number 1 Region: 38-118,192-368
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.98e-81
Family Tail specific protease, catalytic domain 0.0000317
Further Details:      
 
Domain Number 2 Region: 91-182
Classification Level Classification E-value
Superfamily PDZ domain-like 1e-18
Family Tail specific protease PDZ domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|471261159|ref|YP_007644014.1|
Sequence length 456
Comment carboxyl-terminal protease [Bdellovibrio exovorus JSS]
Sequence
MNKKPANKKYLRHTLLFVLVAVVFLGGKPVWTMAEDRYAELQNFSRILALIQQYYVDEVD
TKKLVTGAIKGMLRELDPHTSYMPPDAYKDFESETAGEFGGIGIEISIQNNVLTIISPIE
DTPAWNAGIKPGDKIVAINGQSTKGYSLVEASSALKGKNGEKITLSIVRDNLDKPMDIVI
TRGRVKIRSVKSTDLGHGYLYVKITSFIENTSSDLQKTLTDYKKKNKNIQGILLDLRRNP
GGLLDQAVKVSDLFLNEGVIVSTIGRDPKNKEVVSASKNAPFADVPIVILMNGYSASASE
IVAGALQDNKRAVVVGERSFGKGSVQSAIRLSDGSGLKLTVARYYTPSGVSIQSEGITPD
IEIQDVDAELFAKSIRTGSVSRERDISGHLKGEKEKQDEQSGGSSGSSAVAWWQEIGGKK
ESDLTEKEKLFKSDYQAFQAFSYLQAWKTIKDLKTN
Download sequence
Identical sequences M4V4Z2
gi|471261159|ref|YP_007644014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]