SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471261761|ref|YP_007644616.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471261761|ref|YP_007644616.1|
Domain Number 1 Region: 160-250,341-530
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.39e-60
Family Tail specific protease, catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 204-326
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000163
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|471261761|ref|YP_007644616.1|
Sequence length 668
Comment tail-specific protease [Bdellovibrio exovorus JSS]
Sequence
MLIKILSFSLLISSAAYGQQFTKSLDCNWVDPIQTGFLQNHLSMKQKDKDLQARVIEQYI
KRQDGAKMYLLASDVEKIKTSMKSVFDDVAKTECKFLNEVQEVLVKRVEERTEFVKKHLS
AKDFKFNSETEFVYDPQHKVFATTSDEANEFVKKYIQFQVANYLATDIKMEEAKQRVIKN
YERNLKRIKETKQETLIANYLNSFALSLDPHSSFFSREYYEDFTIDMSLSLEGIGATLSQ
EDGFTTVEALVAGGAASKSGLVKPQDKIIAVSQKNGKMENVVDMELKDVVKMIRGPKGTK
VKLTILRKEDGSNKKFDIELTREKVALEDNAVSIYYQDREVDGVKKKIGIINFPSFYADS
KRGGRSSAADMKKIVAEAKAKKVDGLVLDLSNNGGGSLEDAVKIGGLFIKTGNIVKQSSR
REGMETPLADSDDKVDWNGPLVILTSRISASASEIVSGAMKDYGRAVVVGSDHTYGKGSI
QTVIAVPGELGALKVTIGMFFTPSGYSTQLRGVESDIVIPTQYNVDDIGEKSMDYALPAK
KIDSFISKDAFVDKGESAWSVIKPEWINKIRTRSAQRVAKSEDFKKIVDELEKTKKLGKT
IKVSEVLKEKGEKEKKVKKSRYGSKDEKDKEYLDRAEIQEASDVLLDLISLQTGKDLSLT
SNSTTTKK
Download sequence
Identical sequences M4VPF9
WP_015469499.1.98289 gi|471261761|ref|YP_007644616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]