SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471261808|ref|YP_007644663.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471261808|ref|YP_007644663.1|
Domain Number 1 Region: 31-147,176-237
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.91e-39
Family Crotonase-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471261808|ref|YP_007644663.1|
Sequence length 325
Comment signal peptide peptidase [Bdellovibrio exovorus JSS]
Sequence
MKKWSFRRKFVIGLILILLGIYIYRTSTGYWGDNESRLSKNAILHLEVNGVILNGKKLLT
TLKKYKTDSAIKAIVVDINSPGGAVGPSQEIYYELMRVKQETKKPIVCVSTNLIASGGYY
VALACDKIVVAPGTMLGSIGVIMEFANLEKLYDWAKIQRYSISSGRFKDSGSEYRPMRED
ERLLFQGMIDEVYEQFRNAVIEARQLPHETVAMYADGRVMTGAKAVELKFADSIGTFEDA
VKLAATEAGLGDDYKVFKPKKERTGFMDIFSLNDDVDDLNTLTDVQELMSGKAAISSGAA
KEVIRTVLKTRYLNQPLYLMPGYWE
Download sequence
Identical sequences M4VAL8
gi|471261808|ref|YP_007644663.1| WP_015469546.1.98289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]