SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471262052|ref|YP_007644907.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471262052|ref|YP_007644907.1|
Domain Number 1 Region: 12-311
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.08e-63
Family Crotonase-like 0.0000131
Further Details:      
 
Domain Number 2 Region: 317-499
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.31e-52
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000177
Further Details:      
 
Domain Number 3 Region: 499-637
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 7.82e-33
Family HCDH C-domain-like 0.00026
Further Details:      
 
Domain Number 4 Region: 621-715
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 7.99e-16
Family HCDH C-domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471262052|ref|YP_007644907.1|
Sequence length 716
Comment fatty oxidation complex, alpha subunit [Bdellovibrio exovorus JSS]
Sequence
MSAINLTTKKIGNDEIAILTFDLPNEKVNKLSTPVMTELKAHIEKLQTSNYKMVVFKSAK
PKIFIAGADIEEIQKLKTPQEVQVAVSSGQTIFNQIEDLPMPTLALVHGACAGGGCELIL
ACDYRIATDDSSTRIGLPETKLGILPGFGGCIRLPRTVGLQASLDVILAGKLLNPKKALK
IGLVDYVVHVNLLDGFAETQIQKILAGGAKKRRKTFQPRGVVNKLLEGPLKGVVFKKARE
GVLKATRGHYPAPLAALDVVRKTYGMSDRTRALQIELEHFAECAVTDISKNLIHVFYLTE
MVKKQTGVSSDVKGKAVKQLGVLGAGTMGGGIAYVAADKGIGVRVKDISYEANAKALKHA
RDLWAKLVKKKVIDNYQFTQKMALVSTGLDFAGFKNLDVTVEAIVEDMGIKQKVIGQTAA
EMREDAIIVTNTSSLSVNEMAKGHPRPEYFAGMHFFSPVHKMPLVEVIRGEKSSDETIAT
VFELAKKMGKMPVVVKDGPGFLVNRLLLPYMAEAAFLLAEGMSVEKVDKAYVNQFGMPMG
PFELMDSVGLDVCVKVLNIFRKAFPDRVEVPALMEKLEKNKARLGQKTNLGFYKYEGGRK
TEVDQSIYAELGISAPTNPYSDQECLERGVFAMINESALALDQDKIVDTPHEVDLAMIMG
TGFPPFRGGLMKYADTIGADYVRTQLTKYATERKANRLKPSSKLVERADKKARFYN
Download sequence
Identical sequences M4VA09
gi|471262052|ref|YP_007644907.1| WP_015469790.1.98289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]