SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471262367|ref|YP_007645222.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471262367|ref|YP_007645222.1|
Domain Number 1 Region: 98-199,230-289
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.61e-26
Family Crotonase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471262367|ref|YP_007645222.1|
Sequence length 340
Comment putative periplasmic protease [Bdellovibrio exovorus JSS]
Sequence
MEILQHILLFFSQALIIVVSVIAVLITIATLVAKAKAQKSFDIELLHEKYEDQTQALKQA
LLNESELKAEKKRLKKEEKQKKAEDEKSKNKVFVVDFLKGDIKASDADHLREEVSTILGV
ASAQDEVVVRVESPGGLVHGYGFAAAQLLRFRQANIPLTICIDKVAASGGYLMACTANKV
ISAPFALVGSIGVVAQVPNFNRLLKKHDVDYKEYTAGEFKRTVSLFGEITPQGEAKFKEQ
LEETHVLFKSFVSEYRPQMDIAKVATGEFWYGENAIKLGLVDEIRTSDDYLLSKVKTHQI
IKVSFEPKPTLSDKLSGVLSKALTQVLAKLVEQNSIAKKI
Download sequence
Identical sequences M4VAW8
WP_015470105.1.98289 gi|471262367|ref|YP_007645222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]