SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471262384|ref|YP_007645239.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471262384|ref|YP_007645239.1|
Domain Number 1 Region: 331-531
Classification Level Classification E-value
Superfamily PhoU-like 4.4e-27
Family PhoU-like 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|471262384|ref|YP_007645239.1|
Domain Number - Region: 166-249
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0663
Family Crotonase-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|471262384|ref|YP_007645239.1|
Sequence length 545
Comment Na/Pi-cotransporter family protein [Bdellovibrio exovorus JSS]
Sequence
MLDFQNSYFIILIAGVAMFLYGSSMASTSLEKLMATKITSLMNKLSSSQFLSIGIGIGLT
TILQSSGAVTSMLVGLGNARVIKLAQVMGIIVGTAIGSTLTVQLISFDLSSYALPIFSLS
FIVFFLAKKQVIKNIATVFMGFALLFIGLKMISTSAHYFSQLEILADFFQSIRDNSFYSF
IAAVIFCAFVQSSAVTIGLAMSLASAGVISVHDAVLWVYGANIGTTSVALFASVGSNYIG
KQVAWAHFFYKTLSVIIFYPLTSYFLQFVEGFQATPSRMIANSHFFFNVASAMIFFPFIR
KGAELIEKMFPKGPSDEFGAEFLTLNTYQNSSLAISYAQREIMRMADIVLNMIKDSVHLF
ETEDTTLVQSIKDRDNQVDFLYREIKMFLLDHANQSTTVVHQNIMKMIMFISDLERAADS
IDINIRTLAVKKHALRLEFSSQGLSEIQKMHEQVVKVASMGINAYDNPQMCELAIELKRD
LAKLETMYRENHISRLNQGLRETINTSSIHLDLLSEYRRIASLLCNHAYATTKIKTSDEA
PQDKG
Download sequence
Identical sequences M4V8B6
WP_015470122.1.98289 gi|471262384|ref|YP_007645239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]