SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471263241|ref|YP_007646096.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471263241|ref|YP_007646096.1|
Domain Number 1 Region: 2-252
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.97e-56
Family Crotonase-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471263241|ref|YP_007646096.1|
Sequence length 254
Comment enoyl-CoA hydratase/isomerase family protein [Bdellovibrio exovorus JSS]
Sequence
MKFIKVESPQPDIKVVSLNRPEVKNAFHPEMIAEITNFFQQESQTKTSKLLILKGEGTAF
CAGADLNWMKSMVNYSYEENIEDSKKLWGMFAAVQNCEVPVVAVAHGAVFGGALGLLACA
DYVYADEATQFCFSEVKLGLAPAVITGFITRKIPDAFCRPLMISGEVFNANEARRIGLVH
QTFTGTTVDVTEIVKTFAGNGTEAMREAKKLLNVLLETNSFDEAQAHCTRVIAERRISAE
GQEKLQKFLNRTSK
Download sequence
Identical sequences M4VTI0
WP_015470979.1.98289 gi|471263241|ref|YP_007646096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]