SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471263242|ref|YP_007646097.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471263242|ref|YP_007646097.1|
Domain Number 1 Region: 237-514
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.47e-85
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 23-268
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.99e-71
Family Biotin dependent carboxylase carboxyltransferase domain 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|471263242|ref|YP_007646097.1|
Sequence length 534
Comment 3-methylcrotonoyl-CoA carboxylase beta subunit [Bdellovibrio exovorus JSS]
Sequence
MIIESQIDPNSSDFQQNKTALLEHVNQWRQRIESGKLGGGAEAVKKHKSRGKLTARERIE
ALIDSGTAFLEFSTLAAYEMYEGQAPSAGVLTGIGVIEGTECVIVANDATVKGGTYFPMT
AKKHLRAQEVAMENGLPCIYLVDSGGAYLPMQSEVFPDRDHFGRIFYNQARMSAQGISQI
SVVMGSCTAGGAYVPSMSDENVIVKDNGTIFLGGPPLVRAATGEIVDAQELGGAHTHCEL
SGVTDHFAENDQHAIDLTRSIVKHLNKRKAVQLKTQPIEEPLYAEDEIYGVLPADQRIPF
DIREVIARIVDGSKFHEFKPLFGKTLVTGFAHIWGMPVGIIANNGVLFSESAQKAAHFIE
LCEQREVPLIFLQNITGFMVGKKYEQEGIAKHGAKMVMAVSNARVPKFTVVIGGSYGAGN
YGMCGRAYSPRQLWMWPNARISVMGGEQAANVLLTVKMDQLAAKGQSMTPEEQAEFKRPT
LEKYERESSAYFSTARIWDDGIIDPKDTRRVLALGIAASLNKDWGPKQQGVFRM
Download sequence
Identical sequences M4VDE8
WP_015470980.1.98289 gi|471263242|ref|YP_007646097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]