SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471263529|ref|YP_007646384.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471263529|ref|YP_007646384.1|
Domain Number 1 Region: 227-518
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.87e-88
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000129
Further Details:      
 
Domain Number 2 Region: 3-255
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.49e-77
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471263529|ref|YP_007646384.1|
Sequence length 518
Comment propionyl-CoA carboxylase beta chain [Bdellovibrio exovorus JSS]
Sequence
MTEMMQKKIAELEKRNELAMAGGGPEKKAKHKQGGRLTARERLDVLLDPGSFVEMDRFVT
HRCTNFGMEKNKPYGDGIITGYGRINGKLVYVSSQDFTVTGGSMSRTQANKICKVMDLAI
KNGAPFISINDSGGARIQEGIESLGGYADIFTRNVMGSGVIPQITAIMGPCAGGAVYSPS
ITDFVFMVENTSYMFVTGPDVIKAVTHEEVTKEQLGGAATHSQKSGVAHFTAKDDKHCLL
LIRELMGFLPSNNLDDSAALATKDRPDRIVDSLNALIPDNPKKPYDMLQLISEVVDEGYF
LEIHKHFAQNIIVGYARFNGRPVGIVANQPQVLAGCLNIEASRKAARFIRFCDAFNIPIV
SFVDVPGFLPGKDQEWNGIITHGAKLLYAYAEASVPKVTLITRKAYGGAYIVMGSKLLRS
DVNLAYPSAEIAVMGAEGAVNIIQREAIAKAKDPATERARLTAEYEEMFSNPYVSAELGY
TDEVIEPALTRKRIIDSLEMLKNKRDIIPPKKHGNIPL
Download sequence
Identical sequences M4VBK3
WP_015471267.1.98289 gi|471263529|ref|YP_007646384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]