SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471261489|ref|YP_007644344.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471261489|ref|YP_007644344.1|
Domain Number 1 Region: 670-747,844-1051
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.82e-64
Family Tail specific protease, catalytic domain 0.000000142
Further Details:      
 
Domain Number 2 Region: 8-264
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 6.54e-27
Family Tricorn protease N-terminal domain 0.0000194
Further Details:      
 
Domain Number 3 Region: 197-481
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 3.41e-26
Family DPP6 N-terminal domain-like 0.02
Further Details:      
 
Domain Number 4 Region: 757-842
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000592
Family Tail specific protease PDZ domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|471261489|ref|YP_007644344.1|
Sequence length 1078
Comment hypothetical protein A11Q_517 [Bdellovibrio exovorus JSS]
Sequence
MNQGYFSQPTISGSQIAFITDDDLWIVERHRNMGAAVARRITANKGNILSPCYSPDGQWL
AFISTDTAAEGDIYVMPAQGGEAERMTWLGVQRIINWKDNNTLRFVNGMDGYPNREAHVY
ELNVKTRDFSKVNLGPASYYYAGKNFQVLARNSGDSARWKRYQGGTAGVLWVQKEKGKFQ
RILKDISTNITRPEIIGTNIYFISDHEGVGNVYTCDLAGKKLRRLTDHIDYYCRNLRSDG
QTLVYQAGADIYTYDLATEVEEKVEIECHTTAMQSMPRYENWSRFFHGMELHPKSSELCL
ASRGRLFEMAPFSGPVKELDVQKRIRYSYPSYNFDGTKLLAAASDADSDEALVLFDLKTD
KYKTLFPQIKWGKIWGIKCSPIHEMAAIITNRKEVYIVDFKKNSSKKIETNMFNRPADLE
WSADGRYLAYTANVDARRTGIRIYDTKKAKLTFLLNPVVSDFSPSFDPEGNYLYFLGIRS
FAPNYNETHFDLGFPFATRPYVVALNDKVLSPFEATLKSPQVDNSVEKPATGKNKKAKST
PTFQEIQFEGLENRVQAFELPLGGYGRISAIKNGVIYTKQNVAPIENFDRNQEPPAPDLY
VYRFDDGTQEVYHKAVKAFAVNTAKTHVLLHHDVKIRLLDVKLKPSQESKIGKKDGYVDV
SRIKLKVEPRLEWKQMYHEAWTLQKEHFWRQDMSKVDWNLVYKRYHKLLGRVKTRSEFSD
LMWEMQGELGTSHCYEMSGQYTRVGSGVPHARLGAYFQYRPSAQAYEITRILAGDSWSNA
DGNSPLTSMGVSLKVGDRIMAVDGIRFVQASDLYELIENKAAMKVELTVHRKGAKSEEKV
VVKTNRQQKAAWYREWVEKNKKYVHEKSKGKLGYVHVPDMGAYGYSEFYRNFVNESQYEG
LVVDVRYNGGGHVSQHLLKVLAQKVLGFDQTRHQGLEKYPVYAAGVLVALANEQSGSDGD
IFPHSFKLMKLGKLIGKRTWGGIIGINGQYSLSDGTYVTQPEYSFWFKDNEWFVENHGVN
PDIEVDITPEDYRDKKDPQLDRAITEALSDLKSNPSVKFKPSYYPDLSIPKKLTRLNR
Download sequence
Identical sequences M4V5V0
WP_015469227.1.98289 gi|471261489|ref|YP_007644344.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]