SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471263493|ref|YP_007646348.1| from Bdellovibrio exovorus JSS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471263493|ref|YP_007646348.1|
Domain Number 1 Region: 262-371
Classification Level Classification E-value
Superfamily TPR-like 8.72e-16
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Weak hits

Sequence:  gi|471263493|ref|YP_007646348.1|
Domain Number - Region: 120-276
Classification Level Classification E-value
Superfamily TPR-like 0.0152
Family Transcription factor MalT domain III 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|471263493|ref|YP_007646348.1|
Sequence length 401
Comment O-linked GlcNAc transferase [Bdellovibrio exovorus JSS]
Sequence
MLKHGLSGLFFIASALFCLDLGHAQTAQSPVEALANALSTVQPIPPPAATTPPPANNSGN
PAGGASGGAGANAPAGPTPTTPSSNLGGKYEEHQSICRMNEYDLVKDFSDDLKKRRVELI
KTKLKNESNEQRVKTQIRLIKEYLDQKNNLAAGALIQEMKQQKLSGFDNEYVNSLAALSE
NRISVARQILNKMSLEKENASNVELLRSLAEVYIAESNYYEASTLYEDLNALTKNAYLPQ
LCEVMTLNTMNAEAERICLQASSRFPQNPFPPIFQGITHRERLDLKQAESLFKKSIAIKP
TEMGHSCLAEINFMNKKFTEAASEYKKALEVTPTSNRALLGLAWTEIQSKNYTEAIEAFK
KACKLNSKNEVEIRKAFKYLNDEKIAEAPRFIEAVNSCSGS
Download sequence
Identical sequences M4VFB2
WP_015471231.1.98289 gi|471263493|ref|YP_007646348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]