SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291294867|ref|YP_003506265.1| from Meiothermus ruber DSM 1279

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291294867|ref|YP_003506265.1|
Domain Number 1 Region: 89-324,462-591
Classification Level Classification E-value
Superfamily Subtilisin-like 2.88e-75
Family Subtilases 0.00011
Further Details:      
 
Domain Number 2 Region: 354-418
Classification Level Classification E-value
Superfamily PA domain 0.0000000000000693
Family PA domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291294867|ref|YP_003506265.1|
Sequence length 860
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Meiothermus ruber DSM 1279]
Sequence
MRKLLLLVGMSALLAACGGPRSSKPSLEVIASLPPAPASPMVDETPTRWFVELSGGAVSD
GISLQSIQAQHAAFRQAAQAAGVKILFAYTQLFNGFSVEVPGNNRKLLYTLPGVEGVYPI
GTYKLPPREAANPDLASAITQTGADIAQNDLGLTGRGVKVGIIDSGIDLEHPAFAGRIVD
GYDFVGDAYDASDPAKSTPVPDPNPDDCDGHGTHVAGIVGGKDSQITGVAPGVQFGAYKV
FGCEGSTGDDVILAALERAETAGMDVVNMSLGSPFGWSVLGKSITKMVKRGTVVVASAGN
NGNLGLFATGDPAATEGVLSVASFDNIAVNAQKAVVNATGAPLGYLVLGGAEAPPTSGTS
AEVVWVGRGCNADALLADPNGKVALMERGACTFNEKYQKAVAAGAVGVIIHNNAPGLFAG
GGVAGVAGKFGISISQADGLALRGLTSPTTLTWTPDTTQVSNPTGNLISSFSSWGLSQDL
KLKPDLGAPGGLIRSAVPLEQGSYAILSGTSMSAPHVAGAVALLLEGNPAFWGPQKPSEV
RKYLQNTAMPKLFALAPSSGLPETSYREGAGMIDIVAAVQNRVTVTPSAISFAEKAGTHT
ERLVLKNRSNVPLIYRPVHLPGPSAFGSIYSPSFAIAPATVSFSHTQVTVPARGEAVLTV
TITPPAGLPNKGLFGGYILLQPVGAGLMMNVPYVGMQGGYQAVQILTPASAGFPLLGKLN
AAGTGYDLLPSGGTFTLQGNDLPVVLAHFEHGAQVYEMVILNAATNAPIHPKYSRADYGE
YIPRNSSANGFFAIPWDGTRITRYAKEDVYGNKIPVPSEFQAVPDGQYKLQLRVLKPTGR
MSNPADWESWISPVITIDRP
Download sequence
Identical sequences A0A0S7AQ39
gi|291294867|ref|YP_003506265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]