SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291294881|ref|YP_003506279.1| from Meiothermus ruber DSM 1279

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291294881|ref|YP_003506279.1|
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.61e-99
Family Methylenetetrahydrofolate reductase 0.00000000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291294881|ref|YP_003506279.1|
Sequence length 291
Comment 5,10-methylenetetrahydrofolate reductase [Meiothermus ruber DSM 1279]
Sequence
MKVSTLLQSGKPLFSFEFFPPKTPRGEAALFRTLHELKPLKPAFVSITYGAGGSERNKTA
EWAARIQNEVGLPAMAHLTCVGSTREELLARLHEYARAGVENIMALRGDPPQGAREFQPV
AGGFRYAAELVALIRAEFGDRFTVAGGAYPEGHIEAVSLEADLRHLKQKVEAGLDFVVTQ
LFFNNALYFGFVERARRIGIQVPIVPGLMPITDLAQVRRFMDLCGASIPGPLLSRLERAQ
SPEEVLEIGVEHATRQAQELLEAGAPGLHLYTLNKSPATRRVMQNLQMVLR
Download sequence
Identical sequences A0A0S7ALM0 D3PMT4
WP_013012778.1.12476 WP_013012778.1.70660 WP_013012778.1.78507 WP_013012778.1.82968 gi|291294881|ref|YP_003506279.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]