SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291295136|ref|YP_003506534.1| from Meiothermus ruber DSM 1279

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291295136|ref|YP_003506534.1|
Domain Number 1 Region: 3-252
Classification Level Classification E-value
Superfamily Folate-binding domain 6.44e-51
Family Aminomethyltransferase folate-binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 264-321
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000106
Family Aminomethyltransferase beta-barrel domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291295136|ref|YP_003506534.1|
Sequence length 325
Comment folate-binding protein YgfZ [Meiothermus ruber DSM 1279]
Sequence
MVLQDLHESLKVTWRTQDEFQIPWHYGNVEAELEALQQGAALLDFSNHGLLELRGPDGTE
FLHNQCTSNIRAMLPDSWLETLFLSARGQIEHLGLVFNLGNSFWVSSPSARALAERFRKF
IVFDQVEIEALPWSLLRLHGPGAEAVAQQLTALPPRWGLVKTPHLVLARDEFGLWFLVPA
SQAYQLAQRLLEAGASPVGHQAWHIWRVERGIPDLPEALGELPQEAGLEGRVSYKKGCYL
GQEIMARLEARGNTRYQLMGLLGQKELPSGAEIFREGKRVGRVGTAVESPRLGAIALALL
RKELAPGDQVHVEGWSATVSGLPMP
Download sequence
Identical sequences A0A0S7APL4
gi|291295136|ref|YP_003506534.1| WP_013013033.1.12476 WP_013013033.1.70660 WP_013013033.1.78507 WP_013013033.1.82968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]