SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291295241|ref|YP_003506639.1| from Meiothermus ruber DSM 1279

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291295241|ref|YP_003506639.1|
Domain Number 1 Region: 102-199
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 1.44e-21
Family Siroheme synthase middle domains-like 0.0045
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000000157
Family Siroheme synthase N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291295241|ref|YP_003506639.1|
Sequence length 221
Comment siroheme synthase [Meiothermus ruber DSM 1279]
Sequence
MLNLQGKKVLFIGGGLETASKVQKLLEQGAWVRLVSPLYHPELAQALHQGLLEWQQRSYT
YGDLAGFTLCFSHPVDPSLNSIIAQEARERGVWLNAVDDPAHCDFILPSVHRQGDLVLAV
STSGVAPALAVRIRERLAAEYGPEYAEYLELLRSFRPLVKEAYPHSFEARKAAWYRMIDS
EALDLVFLGERERARAVLLQSLYSPTSPSPDGHAAPWQEVV
Download sequence
Identical sequences D3PPZ3
gi|291295241|ref|YP_003506639.1| WP_013013138.1.12476 WP_013013138.1.70660 WP_013013138.1.78507 WP_013013138.1.82968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]