SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291295523|ref|YP_003506921.1| from Meiothermus ruber DSM 1279

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291295523|ref|YP_003506921.1|
Domain Number 1 Region: 33-415
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.83e-103
Family Homocysteine S-methyltransferase 0.0000019
Further Details:      
 
Domain Number 2 Region: 924-1215
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.49e-85
Family Methionine synthase SAM-binding domain 0.00053
Further Details:      
 
Domain Number 3 Region: 373-638
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 2.49e-72
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0011
Further Details:      
 
Domain Number 4 Region: 760-888
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 8.37e-37
Family Cobalamin (vitamin B12)-binding domain 0.00011
Further Details:      
 
Domain Number 5 Region: 674-755
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.4e-23
Family Methionine synthase domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291295523|ref|YP_003506921.1|
Sequence length 1215
Comment methionine synthase [Meiothermus ruber DSM 1279]
Sequence
MSVSAPRDFFAEQGVEPLTAQGYAREARAQAFPYLKTLSERVLVYDGAMGTEIFKYNLGD
ADFGGPQYNGCPEILNRTRPDVIAAIHRSYLEAGADVIETNSFGSMPHVLAEYGLEAEAE
DLAYAAAQIARSEADKKSAEKPRFVAGSLGPGTKLISLGQIGWKEMFESYRTAARGLIRG
GVDLLIIETCQDVLQVRCAVLASRQAMQDLGREVPLQVQVTFEATGTLLVGSDDGAALTV
LESLPVDVVGINCAVGPDLMDSHIRHFCQHSTRWVACLPNAGLPRNEGGRAVFDLTPAEL
ARWQLKFVREYGLNVVGGCCGTGPEHIRALVEALGGCHTPPLRSSQQAQTPSPLGQVASL
YQSVPLRQDTGILIVGERTNATGSKKFRELLFAGDFDGMEALANEQVAEGAHVLDVSVAW
TGRDEVRDMREVLKRFATSVPIPIMVDTTQPEVMEEALKHLGGRAILNSINLEDGLEKFD
RVAALAKRHGAALVALTIDEDKEAGMAKTVERKVEIALRIYERLTQVHGIAGESILFDLL
TFPITQGDEDTRKLALWTIEGIRQLRQQLPEVGFILGISNVSFGLSPQARVVLNSVFLDE
CIRAGLTAAILNAGKILPINQIPQEQYQLALDLIYDRRQFGPAGEVIHDPLFAYVDYFAK
NKVDKAQARDPLAGLELEERLKKRIIEGRKVGLEADLEQALGKYSPVEIINQILLEGMKV
VGDLFGAGKMQLPFVLQAAETMKAAVRYLEPRMEKLEGVHKGTMVIATVKGDVHDIGKNL
VDIILSNNGYKVINLGIKKPIEEILAAVEEHRPDVVGMSGLLVKSTVVMKENLEYMAARG
ISLPVVLGGAALNRHYVENDLRRVYTTGQVYYASDAFDGLQLMEELTGHAPPRLTSREVS
GHKYKTAYEILQEKLMAGSEYIPSNTPPAPRIPRPPFWGRRVVDKSELEIGVISRYVNKN
ALFRGQWGFRKGEMSQPEYEAYLERLAEPMFEEMVLQAMAEGWLEPAVVYGYWPVASDKN
ELIVFDPDSGAELFRFNFPRQMGAGSRHLCIADFFRPRHAPPIGDEQGWFPPAAWANGAR
DVLAAQVVTMGRKVSQVAQELFQSDAYQDYLYLHGFSVEMAEALAEYWHKRIRQQLDIAQ
DDATSLEELFRQGYQGSRYSFGYPACPRLEDQKYLQELLQWQEIGVELSEEYQLHPEQST
SAIVVHHPAAKYFNL
Download sequence
Identical sequences D3PR18
WP_013013420.1.70660 WP_013013420.1.78507 gi|291295523|ref|YP_003506921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]