SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291295865|ref|YP_003507263.1| from Meiothermus ruber DSM 1279

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291295865|ref|YP_003507263.1|
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily AF1862-like 5.62e-30
Family Cas Cmr5-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291295865|ref|YP_003507263.1|
Sequence length 130
Comment Cmr5 family CRISPR-associated protein [Meiothermus ruber DSM 1279]
Sequence
MPQTRNQKDMKRALELVSSLEQADPELKRIYGGLCHSFPVMVLQSGLCQAVAFSADKASG
EGPRARAHQKLLEHLGAILEVEGDLLAHLHQAPTTVYMHHTRRVLEAWVYFKRFAKSVLK
VETGGDDEGR
Download sequence
Identical sequences A0A0S7APX2
WP_013013745.1.12476 WP_013013745.1.70660 WP_013013745.1.78507 WP_013013745.1.82968 gi|291295865|ref|YP_003507263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]