SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291296706|ref|YP_003508104.1| from Meiothermus ruber DSM 1279

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291296706|ref|YP_003508104.1|
Domain Number 1 Region: 3-545
Classification Level Classification E-value
Superfamily Urocanase 1.57e-238
Family Urocanase 0.00000000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291296706|ref|YP_003508104.1|
Sequence length 550
Comment urocanate hydratase [Meiothermus ruber DSM 1279]
Sequence
MSYKAPRGNQRTAPGWIQEAAKRMLLNNLDPEVAEKPEELIVYGGRGKAARSHADLQRIL
AVLERLQNDETLLVQSGRAVGVFKTQPLAPRVILANSNLVPNWATWEEFDRLDRLGLMMY
GQMTAGSWIYIGTQGILQGTYETFAAAARKHFGGSLKGTITVTGGLGGMGGAQPLAVTLN
GGVAICVEIDPERIQRRLDTAYLDVRADSLDEALRLAEEAKRKGQPLSIGLLGNAAEVLP
EMVRRGFTPELVTDQTSAHDPLYGYIPVLKADEDPALLRQRDPEGYKKRVLSDMAAHCRA
MVEMQKNGAVAFDYGNNLRAFAKLGGFEEAFSYPGFVPAFIRDQFCEGRGPFRWVALSGK
PEDIYKTDQAILKLFPEDAGLSRWLTEGVKKFKFQGLPARICWLGYKERDKAGLLFNEMV
RKGELEAPIVIGRDHLDAGSVASPYRETEAMLDTSDAVADWPILNFALNAVSGAAWVSFH
HGGGVGMGYSLHAGQVTVADGSEEAAFRLERVLTNDPGTGVMRHAHAGYEQAKQVARERG
LDLAGWEQTG
Download sequence
Identical sequences D3PLJ3
gi|291296706|ref|YP_003508104.1| WP_013014582.1.70660 WP_013014582.1.78507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]