SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291296769|ref|YP_003508167.1| from Meiothermus ruber DSM 1279

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291296769|ref|YP_003508167.1|
Domain Number 1 Region: 8-131
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.26e-49
Family Nqo15-like 0.00000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291296769|ref|YP_003508167.1|
Sequence length 134
Comment NADH dehydrogenase (quinone) [Meiothermus ruber DSM 1279]
Sequence
MSAAHDHKHEEMLYRAWVQVIEWMKEYAAEKGVQFSKESDFPDFIYRMERPYQLPTTMMA
VSLSDERGEPFFFASVSPRHAKLKHVAFRVPGGHVHYHAHWEEGQGLVLEGKFPLTKEKL
YQMADRARAALVRA
Download sequence
Identical sequences A0A0S7AUF9 D3PLQ6
WP_013014645.1.12476 WP_013014645.1.70660 WP_013014645.1.78507 WP_013014645.1.82968 gi|291296769|ref|YP_003508167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]