SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289581035|ref|YP_003479501.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289581035|ref|YP_003479501.1|
Domain Number 1 Region: 16-73,217-419
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.44e-46
Family Bacterial dinuclear zinc exopeptidases 0.0055
Further Details:      
 
Domain Number 2 Region: 80-200
Classification Level Classification E-value
Superfamily PA domain 0.000000000000131
Family PA domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289581035|ref|YP_003479501.1|
Sequence length 454
Comment peptidase M28 [Natrialba magadii ATCC 43099]
Sequence
MTDADRQLTGDAVARAIGRAWTDDSAWELLTDLTELPNRMGGSPGERRAAELVRESFTDA
GLDDARIDEFDMQYWERGTSELTVETNSLSRQFETIALPYSPAGDVEGRLVDVGYGTPAE
IDAVDLEGAIAVASTTTPADRRFVHRMEKYGHAVEAGASAFVFVNHVPGQLPPTGSLRFN
EEGEIPAVGVSAESGDWLSEYASRAEDVRAHLHVDARTTDGTSQNVHATLGSDTDDFVLV
LAHYDAHDIGEGALDNGCGIATVAGAARILAAVEGVLESQVRIAGVGCEEIGLLGAEALA
DDLDPDSIRAVVNVDGAGRFRDVQVYSHASEELEELAASVAGGAGQPVVHEPDPHPFSDH
WPFLQAGVPSVQLHSEPPKGSDRGRGWGHTSADTRDKVDPRNLREHAILTTLLVWELTRT
DVASIAVDDLRERLVEQDYEPGMRAAGIWPVGWT
Download sequence
Identical sequences D3SSZ3
gi|289581035|ref|YP_003479501.1| WP_004268020.1.6702 WP_004268020.1.81346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]