SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289582887|ref|YP_003481353.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289582887|ref|YP_003481353.1|
Domain Number 1 Region: 5-61,201-401
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.56e-47
Family Bacterial dinuclear zinc exopeptidases 0.0072
Further Details:      
 
Domain Number 2 Region: 74-186
Classification Level Classification E-value
Superfamily PA domain 4.19e-16
Family PA domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289582887|ref|YP_003481353.1|
Sequence length 436
Comment peptidase M28 [Natrialba magadii ATCC 43099]
Sequence
MTTWISDVFTSDVGWTHLENLVDIGNRMAGSDGEREAAELTRDALAEAGARNARLESFDI
QGWTRGDSAVVAPDEELECIALPRSPSDEATGELVDLGYGLPEDFEDADLEGKIAMVRSD
IPEYYERYIHRREKYYHAVDQGAVGFVYRNHVEGCLPPTGSVGTKDDPIGDIPAVGVSSE
VGARLARRYDGEEIAVSVEADIDDATSQNIHAELGPETDERVLVTSHVDAHDIAEGALDN
GAGTAMVVELANALAAREDELETRVEFVAYGAEEVGLVGSGYHAEQADHGSIKAIVNNDG
VVRGRTLSLTTHGFPELEAAAEEVAERHGHPIETVPQLGPHSDHWPFVQWGVPGYHVMST
SDEVGRGWGHTFADTLEKIEKRTLREQAILLTELTVDLAREEQTIEHREPAEIAADLEDQ
NLAEGSKITGDWPYDN
Download sequence
Identical sequences D3SS17
WP_004215996.1.6702 WP_004215996.1.81346 gi|289582887|ref|YP_003481353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]