SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289937490|ref|YP_003482092.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289937490|ref|YP_003482092.1|
Domain Number 1 Region: 16-65,211-410
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.04e-44
Family Bacterial dinuclear zinc exopeptidases 0.0041
Further Details:      
 
Domain Number 2 Region: 83-193
Classification Level Classification E-value
Superfamily PA domain 0.0000000000275
Family PA domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289937490|ref|YP_003482092.1|
Sequence length 456
Comment peptidase M28 [Natrialba magadii ATCC 43099]
Sequence
MVSLPNQIVGDAYTSTHGWQLVEALADLRDRMPGSEGERAGADLVAEQFEEIGLDNVSST
EFQIPGWERNSASVTVDDYDLFKRSHEVVALPGTPAETTSAELIDMGHALPEDFEDVDLD
GKIVMASSLTPDDYGRWVHRGEKYSYAIEAGAAGFIFVNHIEGCLPPTGSIGDRNGPGAI
PAVGVSKEVGDRIKRFCRDNTTEATIAVDCQNTEATSRNIEATVGPDTEEEVLFTAHVDA
HDVGDGANDNGVGCALVTEVGRLLKQIEDDLETRVRLVTFGAEETGLYGAYYWTHTHDLD
QVKCVLNMDGAGYSRNLSIHTHGFDAIGEAFEEVSEEFGVPIDVESGIRPHSDHWPFVQR
GIPGAQGRTTAEDSGRGWGHTHGDTLDKLDIRDLREISTLLTAGVLKLSETSREIERVDD
VEIRDATEEQRFDVGMKATGSWPWGDEVRVWPWDDA
Download sequence
Identical sequences D3T1S1
gi|289937490|ref|YP_003482092.1| WP_004216310.1.6702 WP_004216310.1.81346 gi|289937490|ref|YP_003482092.1|NC_013924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]