SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289937491|ref|YP_003482093.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289937491|ref|YP_003482093.1|
Domain Number 1 Region: 18-56,201-407
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.75e-43
Family Bacterial dinuclear zinc exopeptidases 0.038
Further Details:      
 
Domain Number 2 Region: 81-166
Classification Level Classification E-value
Superfamily PA domain 0.000000000000051
Family PA domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289937491|ref|YP_003482093.1|
Sequence length 440
Comment peptidase M28 [Natrialba magadii ATCC 43099]
Sequence
MANRTDWIGRSYTSDIGWDVLYQLAEIGNRLGASDGERQGHACLSQAFEEIGVHDVHDQT
FELTKWERKDSSVSTSAPSDNNFEAIALPGSPAGEISGEIVHLGYGLPEDFEEADLDGKI
VVARSDVPKHHDRWMHRREKYFHAYNAGAAAFIYQNHVEGCLPPTGSLGGGEDVMGPLPA
VGVSKEVGERLRLYASEGTIEGNVTVDVDVGNGESRNVVGTLGPDTEETVLVGAHVDGHD
ISEGALDNASGVAVLCEVARALADREGDLERKVTLIGFGAEEFGLVGSMKYAKNTDLENV
LGIVNCDGAGRARDLIAKTCGFPKMQEVVTDVTDSLRHPVRIVSGVNTHSDHWPFVQRGI
PGVQLQSETGQGRGFGHTYADTLDKTDVRAIREHGILASLIVEQLAANEPIDHRTPESIA
DELREEGLEEPMRVAGDWPY
Download sequence
Identical sequences D3T1S2
gi|289937491|ref|YP_003482093.1|NC_013924 WP_004216311.1.6702 WP_004216311.1.81346 gi|289937491|ref|YP_003482093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]