SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|289937597|ref|YP_003482199.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289937597|ref|YP_003482199.1|
Domain Number 1 Region: 29-144
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000151
Family Tetracyclin repressor-like, N-terminal domain 0.082
Further Details:      
 
Weak hits

Sequence:  gi|289937597|ref|YP_003482199.1|
Domain Number - Region: 236-328
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000142
Family Retroviral integrase, catalytic domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289937597|ref|YP_003482199.1|
Sequence length 338
Comment transposase [Natrialba magadii ATCC 43099]
Sequence
MLLLLMDHLDEISVEELQDALDRVEGAKPTQRLLAAIAYKNGVNQTELAEWHDTGRRTIY
SWLMRLDTDEPLEQAVSDAHRSGRKRKLSEKEQQEFEETVHRSPEEVGFDAPAWTPALVQ
QHLAETYDVEYSIPSCRRLLKEAGLSYQKPRRTAAESEAEEQEAFREELKKKRREMDATV
VCIDQTKKSVQVEPRAAWFPRGTRPSVELSGQRDWTCLLGAITEDGDRFFARFEEYVTAD
HAKHFILASCNEFEEDLIIVLDGAPYFRASAVTDLAARDDLAFVTLPAYSPELNPVEECW
RQLQAALSNRFFGSLNELTTAIDTAIDQITVPKVSNYF
Download sequence
Identical sequences gi|289937597|ref|YP_003482199.1| gi|289937597|ref|YP_003482199.1|NC_013924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]