SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289581356|ref|YP_003479822.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289581356|ref|YP_003479822.1|
Domain Number 1 Region: 51-305
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000000000803
Family Transferrin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289581356|ref|YP_003479822.1|
Sequence length 385
Comment phosphate/phosphonate ABC transporter substrate-binding protein [Natrialba magadii ATCC 43099]
Sequence
MSQDSGTSTNSRRRFLTKTGAVGTLALAGCLGRSEETDGDGGNGSGDSTETITWVMNPAE
DTIDIEVQYQPLFELIEDEFDVEIEGLPTQSYSGTMVELERAGEGDMTLADTSPGAVPQL
GPEEIDVVGMREAFGAERYFGTLVTTADSGITDVSDLEGEAVAMADVGSVSGGMAPLWML
HEAGLDIGNVAEGGGAEDFEWRSGVSHDLAVEELINDDTIAAAGAGEFASVPHVPVEQIE
DEYPDLYEISPEVDIAGTRDPELRLLDVSPAIPRAPIVVNAGWQDDLRSDIEEFMQNVEA
EELQHDAFDLADELGLDLPDEMLEEYNEGTLDTDDYDLDEDQEADWQDFDDHTLWFSGIV
AADHEDYEPVRDFAEDLDIAFDDIE
Download sequence
Identical sequences D3SUK2
gi|289581356|ref|YP_003479822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]