SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289583554|ref|YP_003481964.1| from Natrialba magadii ATCC 43099

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289583554|ref|YP_003481964.1|
Domain Number 1 Region: 58-391
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.17e-46
Family Phosphate binding protein-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289583554|ref|YP_003481964.1|
Sequence length 392
Comment hypothetical protein Nmag_3861 [Natrialba magadii ATCC 43099]
Sequence
MWCEQITKSMVERNISRRTVLKTTVAGGAAAAAGCLGGGDDREYVRPIDVDLDDVEPENE
INMWNWFYDFRDWTVEEFSAEYGIESSSSTGYSSAAEWYSRLEAGNHAIDHVGSTGNYTV
RSVENDFFEPLPVDQFEGWEALPDFLQDTMHDYAGKDGEVYAMPQSLLLYPTLTYNEDHF
SSPPDSWGVLWDEEYAGDICMWDEAQYPCQIAALYTDQDPFDPDDLDEIQEVLEQQIDLN
ETLWDEYNHARGLFVNEDVVVGPLLDGQTYLARFEDEAPINYTIPEEGGLYQLDDMAIPT
DCPNPRAATLLMDWVTQPDNLKNIFHESGYPPAIDHDDFEELYAEDLEEGTITEEEIEFF
RWGELEDRLMFAEPLGDDLLQTYDQIWTEVKN
Download sequence
Identical sequences D3T1E3
gi|289583554|ref|YP_003481964.1| gi|289583554|ref|YP_003481964.1|NC_013923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]