SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288554151|ref|YP_003426086.1| from Bacillus pseudofirmus OF4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288554151|ref|YP_003426086.1|
Domain Number 1 Region: 3-133
Classification Level Classification E-value
Superfamily FlgN-like 0.00000000000353
Family FlgN-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288554151|ref|YP_003426086.1|
Sequence length 165
Comment flagellar protein [Bacillus pseudofirmus OF4]
Sequence
MSAQLVIQALAELLKLHQELNKTAVQKLGAIKANDMNALGQVVREEAKLIRAIQTADAKR
VRTAEEFMRHKGEGREDATVQTLLTYTEGEDRLMIERLQKALLKEVRRLSEQNEQNKELI
EESLRFVNLSLDLMVPQTEDVHYQNPTNKQDQTELYSRSAFDSKA
Download sequence
Identical sequences D3FYH1
WP_012960467.1.97837 gi|288554151|ref|YP_003426086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]