SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288556506|ref|YP_003428441.1| from Bacillus pseudofirmus OF4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288556506|ref|YP_003428441.1|
Domain Number 1 Region: 127-289
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.88e-28
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0089
Further Details:      
 
Domain Number 2 Region: 55-104
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000152
Family AraC type transcriptional activator 0.025
Further Details:      
 
Domain Number 3 Region: 3-53
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000824
Family AraC type transcriptional activator 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288556506|ref|YP_003428441.1|
Sequence length 292
Comment putative AraC-related transcriptional regulator [Bacillus pseudofirmus OF4]
Sequence
MLKRMNDAIDYIEDHLNEEIDSQKLEKITGTSIYHFRRMFSYLSGMSLGTYIRNRRLSMA
MSDLLRENVSVTETAFKYGYESVDGFTRAFKEWVGFTPSEVKQHESHKLQAFPKLSFQLT
IQGGMKMEYKIVKKDAFKIAGVKKRVPIQFEGVNKEIENLAASITEKQYETMNGLKNMEP
YQVVNASYQFDEGRSEEKGYLEHMIGVPTTKEGPYDSLESLEIASHTWAIFSSKGRFPKT
MQDTWAKIASEWLPSSDYELVDAPELSYVEDYSNSENVYSEIWIAVKKKTAL
Download sequence
Identical sequences D3FRF8
gi|288556506|ref|YP_003428441.1| WP_012958911.1.97837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]