SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288556096|ref|YP_003428031.1| from Bacillus pseudofirmus OF4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288556096|ref|YP_003428031.1|
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily YjgF-like 2.12e-46
Family Chorismate mutase 0.0000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288556096|ref|YP_003428031.1|
Sequence length 126
Comment chorismate mutase [Bacillus pseudofirmus OF4]
Sequence
MIRGIRGATTVVRDEEEEILDVTEELLHEMIAQNSFQAEDVAQVLITVTEDLSAAFPAKA
LRRFSDWTYVPVVCAREIPVPGSLEKCIRLLVTVNTSLAQDKINHVYLREATKLRPDLAN
GNKLAN
Download sequence
Identical sequences A0A1Q9PUT7 D3G054
gi|288556096|ref|YP_003428031.1| WP_012958501.1.66041 WP_012958501.1.97837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]