SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288930712|ref|YP_003434772.1| from Ferroglobus placidus DSM 10642

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288930712|ref|YP_003434772.1|
Domain Number 1 Region: 128-400
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.77e-112
Family BC ATP-binding domain-like 0.0000000136
Further Details:      
 
Domain Number 2 Region: 675-935
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.89e-111
Family BC ATP-binding domain-like 0.000000107
Further Details:      
 
Domain Number 3 Region: 395-556
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 2.09e-53
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000704
Further Details:      
 
Domain Number 4 Region: 559-677
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.24e-52
Family BC N-terminal domain-like 0.0000023
Further Details:      
 
Domain Number 5 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.58e-51
Family BC N-terminal domain-like 0.00000197
Further Details:      
 
Domain Number 6 Region: 937-1075
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 8.77e-43
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288930712|ref|YP_003434772.1|
Sequence length 1081
Comment carbamoyl-phosphate synthase, large subunit [Ferroglobus placidus DSM 10642]
Sequence
MPKREDIKKIMVIGSGPIVIGQAAEFDYSGSQACKALREEGYEVVLVNSNPATIMTDPEM
ADKTYIEPLTPEVVAKIIERETPDALLPTLGGQTALNIAVKLHEMGVLDKYGVELIGANV
DAIKKAEDRDLFKKAMENIGLEVPRSEIAESVSDALTIAEELGYPVVVRPAFTLGGTGGG
IAYNREELKEIVRKGLELSMIHQVLIEESVIGWKEFELEVMRDKADNVVIICSIENFDPM
GVHTGDSITVAPAQTLTDYEYQRLRDAAIAIIREIGVETGGSNIQFAVHPSSDRFLAIEM
NPRVSRSSALASKATGYPIAKIAAKLAVGYTLDEIPNDITKETPASFEPTIDYVVVKIPR
FAFDKFPTADPTLGTQMKSVGEVMAIGRTFEEALQKALRSLEIGRYGLGADGKDKQPSKD
EIVKKLITPNPERVFYIRYALLNGFSVDEVAELTKIDKWFISKIKNILDVERELREAAKK
YSIDEVPKELLRKAKRFGFSDYQIAKIFGVDERDVRKARKSKGIVATFKMVDTCAAEFEA
KTPYYYSTYEEENDAVPSKRKKVMILGSGPNRIGQGIEFDYCCVHAVYSLKEEGYETIMV
NCNPETVSTDYDTSDRLYFEPITHEDVMNIYENEKPEGVLVQFGGQTPLNIAKQLEESGA
KILGTSVDSIDIAEDRKRFAEICRKLGIPQPENGIAFSVEEAKEVAKKIGYPVLVRPSYV
LGGRAMEIVYDEETLERYIREALEVSPEKPILIDKFLEDAIEVEVDAVCDGEEVLIGGIM
EHIEEAGVHSGDSACVLPPQSLSKEVIDKIIDYTRKLALELKVIGLINVQYAVKDNEVYI
LEANPRASRTVPFVSKATGIPLAKIAAKVMMGKKLKELGVKERLFPDHVSVKEAVFPFLK
LPGVDPVLGPEMKSTGEVMGIDYDFGLAYYKAQLAAGMKLPTEGTVFISVRKHDREKILP
VAKKLKEMGFRILATDGTAQFLKEHGIDAEIVPKISQGRPNVIDLIINGEIDLIINTPSG
RRGKTEGYMIRRAAVDYNIPYITTYSGALAAVKGIEAIRKAELSIKSLQEYHEEVKRKYE
S
Download sequence
Identical sequences D3S2G7
gi|288930712|ref|YP_003434772.1| WP_012964844.1.13673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]