SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288931983|ref|YP_003436043.1| from Ferroglobus placidus DSM 10642

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288931983|ref|YP_003436043.1|
Domain Number 1 Region: 192-355
Classification Level Classification E-value
Superfamily RibA-like 7.45e-56
Family RibA-like 0.00000816
Further Details:      
 
Domain Number 2 Region: 27-192
Classification Level Classification E-value
Superfamily YrdC/RibB 7.33e-23
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288931983|ref|YP_003436043.1|
Sequence length 385
Comment GTP cyclohydrolase II [Ferroglobus placidus DSM 10642]
Sequence
MINIFEKNLKNYIPHLGVNDMGYVIYKDDRAAICFPAEEIDREKINVLMKNGDEIRIAMP
WKIIESLGLNSFKFEGKNLISVDFNGDLTASGRLRAIRKILSGDVYDAKFPGKIFIEEVK
ENGVLERPGFGEAAIDVAKMKGYSPISVYAFLLNQEGEFADKSYALKFAEENNFEAFSME
ELISKRLREEKAVKRVVETRLPTKFYGEFKAIGYETPIGEVVALVRGENLEECVVRIHSE
CLTGDVFHSLRCDCGEQLEKALKKIDSENKGVLIYMKGHEGRGIGLINKLMAYKLQDEGK
DTVEANLELGFPPDMRSYGIAAQILLDLGVKKVRLMTNNPEKIEELKSYGFEVVREPIEI
EPSEENLRYLKAKREKLGHFLCIND
Download sequence
Identical sequences D3RZ55
WP_012966108.1.13673 gi|288931983|ref|YP_003436043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]