SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288932457|ref|YP_003436517.1| from Ferroglobus placidus DSM 10642

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288932457|ref|YP_003436517.1|
Domain Number 1 Region: 99-281
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.31e-64
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000754
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 8.32e-41
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00023
Further Details:      
 
Domain Number 3 Region: 318-447
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 8.89e-34
Family SerA intervening domain-like 0.0021
Further Details:      
 
Domain Number 4 Region: 443-525
Classification Level Classification E-value
Superfamily ACT-like 5.73e-18
Family IlvH-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288932457|ref|YP_003436517.1|
Sequence length 527
Comment D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 10642]
Sequence
MKVLVASNIAKEAIELLKAEGMEVDVRADISEEELKEVIKDYDALIVRSKPKVTREIIER
GEKLKIIGRAGVGVDNIDVDAATERGIIVVNAPGGNTISTAELTMGLIISAARKIPQADR
SVKEGKWERKKFEGLELRGKTLGIIGLGRIGFEVAKRAKSFEMRVIAYDPYISPERAKSI
GVELVSFDYLIENSDIITVHVPKTKETEKMISYEEFRKMKDNVIIVNCARGGIVDEDALY
EALKSGKVYMAALDVYEKEPPNFNHPLFKLENVITTPHIGASTKEAQKSVGMIIARDIIN
LYKGLPVINAVNLPSLKPEDFEYLMPYITLAEKMGKIASARLGGNFKEVKITYRGKLANK
DTAYVARALLKGLLETILGANINLVSSMPIAKQRGIRIEESRIESTDSYESLLEVEVKGE
KSISLAGTSFGRDDYRIIRIDRYKVDFVPRGHYIISLHEDKPGVIGRVGTLFGQYNINIA
GMIVGRYGDKPGGVQLMLLLVDDPPTEEVLEKMVKLDGIIDATYIYL
Download sequence
Identical sequences D3S0K1
gi|288932457|ref|YP_003436517.1| WP_012966581.1.13673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]