SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288932704|ref|YP_003436764.1| from Ferroglobus placidus DSM 10642

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288932704|ref|YP_003436764.1|
Domain Number 1 Region: 239-591
Classification Level Classification E-value
Superfamily SIS domain 9.18e-101
Family double-SIS domain 0.000000724
Further Details:      
 
Domain Number 2 Region: 2-219
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.4e-69
Family Class II glutamine amidotransferases 0.00000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288932704|ref|YP_003436764.1|
Sequence length 591
Comment glucosamine/fructose-6-phosphate aminotransferase, isomerizing [Ferroglobus placidus DSM 10642]
Sequence
MCGIVGYIGFRKADSVIISSLKRLEYRGYDSWGVAVKEGNELKLIKKVGAIGDVEAYDVG
NGKIGIGHTRWATHGKPSEKNAHPHTDCSGKIAIVHNGIISNFQSLKEELEKRGHVFKSE
TDTEVIAHLIEENYSGDLLSAVMKALEKVRGSYAIVALHAEKDELVAARHKSPLVLGVGD
EEYIIASDVPAILDYTKRVVYLEDGDVLRIHNGGYTIFHDGKEIDRKIEIIPWSIEDAEK
GGYEHFMLKEIHETPRVIEDTLSEYLDDEITIDASFAFGVSEIVFVACGTSYHACLIGKY
FIEKLADISAKVEYASEFIYHQPPTGRTLVISITQSGETADTLEAMRIAKKRGAKVLTIT
NVLGSTATRIADFVLYTRAGPEISVAATKSFIAQLVVLYLITLKLSHIPRSEKVELLKEL
RLLPEVVKRILDSKEEIERISKLLAKYENLIYIGREVGGPVALEGALKMKEVSYIHAEGY
PAGELKHGPFALLGEKTPVVASLVRDHTYEIMLNNIKEVKARDSIVVVVADEEDKEVEKY
ADFVIRVPKTNPIFSAVTHSVALQLLAYYTARERGCEIDKPRNLAKSVTVE
Download sequence
Identical sequences D3S1M5
gi|288932704|ref|YP_003436764.1| WP_012966825.1.13673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]