SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288931263|ref|YP_003435323.1| from Ferroglobus placidus DSM 10642

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288931263|ref|YP_003435323.1|
Domain Number 1 Region: 17-146,405-524
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 5.1e-97
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00000234
Further Details:      
 
Domain Number 2 Region: 212-378
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.05e-61
Family Group II chaperonin (CCT, TRIC), apical domain 0.00000139
Further Details:      
 
Domain Number 3 Region: 149-216,368-405
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.26e-29
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288931263|ref|YP_003435323.1|
Sequence length 551
Comment thermosome [Ferroglobus placidus DSM 10642]
Sequence
MATLQGTPILILKEGTQRTVGRDAQRMNIMAARVIAEAVRSTLGPRGMDKMLVDSLGDVV
ITNDGVTILKEMDVEHPAAKMVIEVAKTQENEVGDGTTTAVVIAGELLKKAEELLDADIH
PTVIAKGYRLAAEKAMEILDSIAIEVNRDDDELLKKIAATAITGKHAEYAVDHLASLVVE
AVKRVAEEVDGQIKVDEDNIKLEKRQGGGVEDTELVDGIVIDKEVVHPGMPKRVKNAKIA
VLKAALEVKETETDAEINITDPEMLQRFIEQEEKMIKEMVDKIVEAGANVVFCQKGIDDL
AQYYLAKAGVLAVRRVKQSDIEKIAKATGAKIITDLRDIKPEDLGEAELVEEKKVGDEEM
VFIRGCKNPKAVTILIRGGTEHVVDEIERSLTDAIKVVKAALEDGKVVAGGGAPEIEVSL
RIKEWAPSLGGREQLAAEAFASALEIIPRTLAENAGLDPIDILVELRKAHEQGNVYAGVD
VFSGKIVDMRELGVLEPLRVKKQAISSATEVAIMILRIDDVIAAKGLEKEKGKESFESES
ESESESESSED
Download sequence
Identical sequences D3RX35
gi|288931263|ref|YP_003435323.1| WP_012965391.1.13673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]