SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269796400|ref|YP_003315855.1| from Sanguibacter keddieii DSM 10542

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|269796400|ref|YP_003315855.1|
Domain Number - Region: 94-127
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00863
Family Phase 1 flagellin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269796400|ref|YP_003315855.1|
Sequence length 134
Comment flagellar basal-body rod protein FlgC [Sanguibacter keddieii DSM 10542]
Sequence
MTTFGAIGIASTGMTVNRKWLDAVSDNLANINTVRPSDEAAFQARYVVASAVGYPENGQG
VQVAGIELGSAEGRMVHEPDHPLADAEGYVKYPEVDMAGQMSQMIMAQRGYQANASVVDR
AKATYEAALQIGRS
Download sequence
Identical sequences D1BD17
gi|269796400|ref|YP_003315855.1| WP_012868089.1.42826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]