SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269793761|ref|YP_003313216.1| from Sanguibacter keddieii DSM 10542

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269793761|ref|YP_003313216.1|
Domain Number 1 Region: 52-362
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.43e-55
Family Phosphate binding protein-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269793761|ref|YP_003313216.1|
Sequence length 367
Comment ThiB subfamily ABC transporter periplasmic binding protein [Sanguibacter keddieii DSM 10542]
Sequence
MSTTTSTVRASGRPARLTTAAVAGALSLALAACSSSTDAGSDGSGDSAGSPTTVDVVVHD
SFGITDEAKAAFEEESGFTLNVITTGDGGALANKLVLTKESPLGDVAFGIDNSFASRAVD
EGVFEPYTSPALPDGAGDLAVDDTGTLTPVDYGDVCLNVDTGWFDEAGIDAPETLEDLAD
PQYADLTVVTNPATSTPGLSFLFATIGHFGTDGYLDYWSSLTDNGLKVVDGWEDAYYTDF
SASGEGDRPVVLSYASSPAYTVSDDGTSSTTAALLDTCFRQVEYAGVLANGDNPEGAQAF
VDFLLGDQFQSDIPETMYVFPVSPDATIPAEWETFAPVPTSPIALDPAEISANRDTWIKD
WTAQVVG
Download sequence
Identical sequences D1BKA5
gi|269793761|ref|YP_003313216.1| WP_012865451.1.42826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]