SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357410321|ref|YP_004922057.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357410321|ref|YP_004922057.1|
Domain Number 1 Region: 189-475
Classification Level Classification E-value
Superfamily Subtilisin-like 7.33e-83
Family Subtilases 0.00000297
Further Details:      
 
Domain Number 2 Region: 764-853
Classification Level Classification E-value
Superfamily PA domain 0.0000000353
Family PA domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357410321|ref|YP_004922057.1|
Sequence length 1216
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Streptomyces flavogriseus ATCC 33331]
Sequence
MLPAAGPATAAPEPSATRDRPVPDVRAHAITLVTGDVVHWTDGVGGQDTVTVDRPEGATG
GVHVRQAGEDLYVIPDEASALLAAEKLDRRLFNISTLVEMGYDDRRSGGVPLIATYAAGT
GRSQPTAPRGSTKVRTLESVHGVALKAGKDDARAFWNDITRTRKSRSLDGGIAKLWLDGK
VEAALKDSVPQVNAPQAWAEGFDGKGTTVAVLDTGIDATHPDVKDRVKQSRSFVPGEEVV
DGNGHGTHVASTIAGSGAASDGANKGVAPAADLIVGKVLSNEGSGADSGIIEAMEWAKAE
GADVVSMSLGSSIPDDGGDPMAQAVDALSADGGPLFVIAAGNAYGAGTIGSPGSAASALT
VAAVDKQDRRADFSSMGPLVRSYGLKPDLSAPGVDINAAASQSVPGIDGMYQSMSGTSMA
TPHVAGAAAVLKQRHPEWSGQRIKDALMSSSKLLPDHTPYEQGTGRLDVKAAVDTTIEAT
GSVEVASYDWPHSAQDAVAERTLTYRNTGDEDVTLKLATDTDAAAYTLSTPELTVPAGST
AAAVLSIDPSRIANDTRFSGQVLATDPSGATVAHTGFAVNKERELHDLTLRLRDRAGEPM
DGTVVLAALGDTELGLVQVSGETTLRLPPGNYTAWTSADVDGDRSDSKAVAFLSAPETIL
DKATTVTLDASKARRVSVRTPQETETRQLRYDMARTSPEGVVQRDAYQIPLTYDQLWASP
TKKVTQGDFSFLTRWRQGEELIDLTADGHDVPVTVQSGSSVAEDSEQKLTGVFAGNGAAA
DYQGRAVKGKAVVVTRSDTVPPAERLANALAAGAKALFVVNDARGVAMESYAPYGEETTI
PVASVRKGAGGTLIEAARHGRKLSVDQRKFASYVYDLVDRHDGTVPDRSLAFAPSARQLA
KVENTFYGHKATLGGGYRYDIPDYGPGIGFEEYEKFPGTRTEWVTPLPGDSFWYENHSVL
NADASDTAHEMRSAELDHTAGRTYRADWFAPVTGPRLGTAYWGPFRTAGNDVQFNITPWT
DSGEGHSGSMPADEYDTTSFAFHQGDTLLKKGAGRAGYVWDLPAGKLPYRLVIDSERDAA
TWKTSTRTHTEWNFLSGALPDGTERADIPLLQLDYEVDTDLAGDVRAGRTIEVGLASGTQ
AWLDGAVKATRASLSVSYDEGASWSAAELRKGSAGRWTAKLRTPAKGASSVSLRAHTEGP
GGLAVDQEIIKAFGLK
Download sequence
Identical sequences E8WFU2
WP_014153215.1.77427 gi|357410321|ref|YP_004922057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]