SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357410952|ref|YP_004922688.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357410952|ref|YP_004922688.1|
Domain Number 1 Region: 8-210
Classification Level Classification E-value
Superfamily DhaL-like 3.27e-32
Family DhaL-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357410952|ref|YP_004922688.1|
Sequence length 540
Comment DAK2 domain fusion protein YloV [Streptomyces flavogriseus ATCC 33331]
Sequence
MPQSPDVLDAVAVRAWCSLALEALGRQRAAIDAINVYPVADGDTGTNLYFTVESAAAAVE
AVFAAHETGPTVPAHADVVRAMAHGALIGARGNSGTILAQLLRGMAAVLSEAGDADHLRT
ALAEAAAAARLAVARPVEGTVLTVATAAAEAAVATGRDSGLEEVAEAAYEGARAALAATP
GQLPVLGRAGVVDAGGQGLVTVLGALLEAVGGRARGGAVGPAPETLPLTGDCAEPGPDGG
PAFEVIYLLEASDDAVARLRNRLDALGDSLVVVGGDGLWNVHVHVDDAGAAVEAGVEAGR
PYRIRITHFAADRGPAHREPAQRAVVAVVPGDGLSGLCAEAGATTVLARPGEPPASGELV
DAIRRAHAREVVLLPNDAQLRHTAAAAAEQARTEGIRVALVPTRAAVQGIAALAVHEPGR
SFDEDVVAMTSAAGATRYAELAVAERQSWTMAGICQAGDVLGLIDGDVVVIGEDVPGTAR
TVLDRMLSAGGELVTLVLGEDVPDLLGDELSEHIREGYLAVDTVVYRGGRQAAPLLIGVE
Download sequence
Identical sequences E8W8J2
gi|357410952|ref|YP_004922688.1| WP_014153837.1.77427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]