SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357411414|ref|YP_004923150.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357411414|ref|YP_004923150.1|
Domain Number 1 Region: 44-336,404-444
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.95e-90
Family Type II chitinase 0.0000000783
Further Details:      
 
Domain Number 2 Region: 338-406
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000275
Family Chitinase insertion domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357411414|ref|YP_004923150.1|
Sequence length 451
Comment chitinase [Streptomyces flavogriseus ATCC 33331]
Sequence
MRRRTLTGLTTAAGALAMLAGLAPAATAGPSAHDRGPDRHDRVYRSVGYFTQWGVYGRDF
QVKDLDTSGTAARLTHINYAFGNVSAEGRCFTGNVPGEADAWADYARPLDAAGSVDGVAD
TGTQPLAGNFNQLRELKAAHPGLKVMISLGGWSWSTHFSDAARTAASRKALVSSCIDLYI
KGNLPVDGARGGEGAAAGLFDGIDLDWEWPGSAGDTDTVYRPEDKRNFTALVHEFRTQLD
AYARSARKGKAKPKHYELSAFVPTAPAKIDAGFDVPRLMRDFDFVNLQGYDFHVSGETTT
AQQSALYAKGDFSVDQTVRDWIGRGAPARKLVMGMPFYGQGWTGVTGGGDGLGRPATGPA
PATWAAGYEDYKVLKKLAASGAYTVHRDVRNGHAWLFDGTTLWTYDDPQVLRAKTSYIRE
RGLGGAMFWSLDGDTDDGELMAAVARGLGGR
Download sequence
Identical sequences E8WEX0
WP_014154289.1.34797 WP_014154289.1.77427 gi|357411414|ref|YP_004923150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]