SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357412403|ref|YP_004924139.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357412403|ref|YP_004924139.1|
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-77
Family Protein kinases, catalytic subunit 0.000000031
Further Details:      
 
Weak hits

Sequence:  gi|357412403|ref|YP_004924139.1|
Domain Number - Region: 448-508
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number - Region: 381-442
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00406
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357412403|ref|YP_004924139.1|
Sequence length 661
Comment serine/threonine protein kinase with PASTA sensor(s) [Streptomyces flavogriseus ATCC 33331]
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERTLEMTV
GILQALEYSHRAQIVHRDIKPANVMLTRTGQVKVMDFGIARAMGDSGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSTGCLLYELLAVRPPFVGDSPVAVAYQHVREEPQPPSNFD
SEITPEMDAIVLKALTKDPDYRYQSADEMRADIEACLDGQPVAATAAMGAAGYGGYDGYG
NDQPTQALRSTDQGAQTSMLPPVNPDDGGYGYDDRPGRRRQKKNNTSTILLVVAGVLVLI
GAILIGMTLFSSNDDGADGKVDVPNMVGSTVEQAQRLAENSEIVLKVGSKEPCEAQEKGK
ICSQSPGSQEQMATGETVTVVVSTGAPKVEVPDVLEKSEESARKALEDKGFTVNVKTAES
EKTPDSVISQDPEGGSKVEKDTEVTITVAKKTTEPMPDVRTRPYDAAVQQLNGLGFTNVS
RQDVDSEEAAGTVIDQSPAGPSKQSKDVQIVLKVSKGPAQPEQVTVPGDIVGKRFQDAKG
ALEGLGLVVALAPNSSDKPNALVMQADPGANSQVDKGSTVTLTTIGGGGGDGGGFFGGQN
G
Download sequence
Identical sequences A0A285DA38 E8WC07 M9TUT8
WP_014155245.1.34797 WP_014155245.1.77427 WP_014155245.1.83303 gi|479320445|ref|YP_007860496.1| gi|357412403|ref|YP_004924139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]